PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun001500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CO-like
Protein Properties Length: 364aa    MW: 40490.1 Da    PI: 6.6833
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-9332PU_refplantGDBView CDS
gnl|UG|Vun#S45832872PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.45.1e-072164340
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               +r C+ +++  + l+C+ ++  lC +C  e H+       Ht++
  Vun001500 21 ARPCDYCGHSTAVLYCRADSAKLCFSCDREVHSTnqlfskHTRT 64
               678******99*********************668888888876 PP

2zf-B_box27.75.5e-0966109542
   zf-B_box   5 kCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvpl 42 
                 C+ +++ ++++ C ++ + lC++C  e+H +       H+++pl
  Vun001500  66 LCDACDDSPATILCSTDTSVLCQNCDWEKH-NpalsdslHQRRPL 109
                7*****************************.54899999988775 PP

3CCT60.26.8e-21318360143
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                R+ allRYk+K+ktR+++K+irYesRK++AesR RvKGrF+k 
  Vun001500 318 RDSALLRYKQKKKTRRYDKHIRYESRKVRAESRVRVKGRFAKM 360
                899**************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.581966IPR000315B-box-type zinc finger
SMARTSM003361.2E-141966IPR000315B-box-type zinc finger
PfamPF006435.9E-62064IPR000315B-box-type zinc finger
CDDcd000215.12E-72266No hitNo description
PROSITE profilePS5011910.13962109IPR000315B-box-type zinc finger
CDDcd000213.07E-566109No hitNo description
PfamPF006439.1E-766108IPR000315B-box-type zinc finger
SMARTSM003360.1267109IPR000315B-box-type zinc finger
PfamPF062039.0E-16318360IPR010402CCT domain
PROSITE profilePS5101714.485318360IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
XSLNPHSQTS SAMSAEAPKP ARPCDYCGHS TAVLYCRADS AKLCFSCDRE VHSTNQLFSK  60
HTRTLLCDAC DDSPATILCS TDTSVLCQNC DWEKHNPALS DSLHQRRPLE GFTGCPSVSE  120
LLSVVGFGDL SKKSLLSSPQ GSAADGFLGC EIEGLSDFFV WDAPSVVTLD DLICSSASSH  180
SFQAMEVPPL PKNRKAACGR HREEILSQLR ELAKSEPLDL EQYVQPGNLS SAFERDVEVD  240
IYPYHEWHRE RSEPMYQVVP PDPSLRTCTE EVPVKQSTSV GETHTFGDKG GNPSISLNSE  300
TLPTTPKAGA CELTSQERDS ALLRYKQKKK TRRYDKHIRY ESRKVRAESR VRVKGRFAKM  360
EREH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1326332QKKKTRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163062.10.0hypothetical protein PHAVU_001G203000g
RefseqXP_007163063.10.0hypothetical protein PHAVU_001G203000g
TrEMBLV7D1I40.0V7D1I4_PHAVU; Uncharacterized protein
STRINGGLYMA03G36810.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47890.13e-92B-box type zinc finger protein with CCT domain